HPA023623

TRIM16 antibody from Sigma-Aldrich
EBBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023623
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023623, RRID:AB_1858273
Product name
Anti-TRIM16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023623
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVN
IKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQ
QCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQL
DLERKLKLNENAISRLQANQKSVLVSVSEVKAVAE
MQFGE
Storage
-20C
Provider Type Product Number
- No reagents -