Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310274 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pregnancy Specific beta-1-Glycoprotein 5 (PSG5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSG5 antibody: synthetic peptide directed towards the N terminal of human PSG5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNA
SLLIQ NVTREDAGSY- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Activation of the human pregnancy-specific glycoprotein PSG-5 promoter by KLF4 and Sp1.
Blanchon L, Nores R, Gallot D, Marceau G, Borel V, Yang VW, Bocco JL, Lémery D, Panzetta-Dutari G, Sapin V
Biochemical and biophysical research communications 2006 May 12;343(3):745-53
Biochemical and biophysical research communications 2006 May 12;343(3):745-53
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting