H00003802-B01

KIR2DL1 antibody from Abnova Corporation
47.11, CD158A, cl-42, nkat1, p58.1

Antibody data

Product number
H00003802-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003802-B01, RRID:AB_1017487
Product name
KIR2DL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00003802-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KIR2DL1 protein.
Antigen sequence
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHP
GRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTL
RLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVT
HSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVL
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGP
KVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWS
KSSDPLLVSVTGNPSNSWPSPTEPSSKTERMFHHV
GQACLKLPTSSDPTVSACQSNPRHLHILIGTSVVI
ILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANS
EDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKT
PPTDIIVYTELPNAESRSKVVSCP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -