SAB1401221

KIR2DL1 antibody from Sigma-Aldrich
47.11, CD158A, cl-42, nkat1, p58.1
No application information provided.

Antibody data

Product number
SAB1401221
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401221, RRID:AB_10607882
Product name
Anti-KIR2DL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401221
Antibody type
Polyclonal
Antigen
KIR2DL1 (AAH69344.1, 1 a.a. ~ 374 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHP
GRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTL
RLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVT
HSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVL
AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGP
KVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWS
KSSDPLLVSVTGNPSNSWPSPTEPSSKTERMFHHV
GQACLKLPTS
Storage
-20C
Provider Type Product Number
- No reagents -