HPA008026

STK40 antibody from Atlas Antibodies
MGC4796, SgK495
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008026
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008026, RRID:AB_1857603
Product name
Anti-STK40
Provider product page
Atlas Antibodies - HPA008026
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQ
CLARKDGTDDFYQLKILTLEERGDQGIESQEERQG
KMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIV
EDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -