HPA008026

STK40 antibody from Sigma-Aldrich
MGC4796, SgK495
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008026
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008026, RRID:AB_1857603
Product name
Anti-STK40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008026
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQ
CLARKDGTDDFYQLKILTLEERGDQGIESQEERQG
KMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIV
EDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADL
Storage
-20C
Provider Type Product Number
- No reagents -