Antibody data

Product number
ABIN501853
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 614 (ZNF614) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501853
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF614 antibody: synthetic peptide directed towards the middle region of human ZNF614
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
GERPYGCSDCEKAFSHLSNLVKHKKMHTREMGRIS
QVENS CNGESQLLPY
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -