Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008270 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008270, RRID:AB_1845633
- Product name
- Anti-C1orf174
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQK
QNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVS
RFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAK
DDDDDDDDD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Mapping the Subcellular Protein Distribution in Three Human Cell Lines
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
Mapping the Subcellular Protein Distribution in Three Human Cell Lines
Fagerberg L, Stadler C, Skogs M, Hjelmare M, Jonasson K, Wiking M, Åbergh A, Uhlén M, Lundberg E
Journal of Proteome Research 2011 August;10(8):3766-3777
Journal of Proteome Research 2011 August;10(8):3766-3777
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN