HPA008270

C1orf174 antibody from Atlas Antibodies
RP13-531C17.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008270
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008270, RRID:AB_1233609
Product name
Anti-C1orf174
Provider product page
Atlas Antibodies - HPA008270
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQK
QNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVS
RFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAK
DDDDDDDDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -