HPA008270

C1orf174 antibody from Sigma-Aldrich
RP13-531C17.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008270, RRID:AB_1845633
Product name
Anti-C1orf174 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008270
Antibody type
Polyclonal
Antigen
UPF0688 protein C1orf174 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQK
QNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVS
RFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAK
DDDDDDDDD
Storage
-20C
Provider Type Product Number
- No reagents -