HPA008238

MCPH1 antibody from Sigma-Aldrich
BRIT1, FLJ12847
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008238, RRID:AB_1853655
Product name
Anti-MCPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008238
Antibody type
Polyclonal
Antigen
Microcephalin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVD
CNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSC
DGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEK
QNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRT
LNVLLGI
Storage
-20C
Provider Type Product Number
- No reagents -