HPA011209

FGF4 antibody from Sigma-Aldrich
HBGF-4, HST, HST-1, HSTF1, K-FGF, KFGF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011209
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011209, RRID:AB_1848527
Product name
Anti-FGF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011209
Antibody type
Polyclonal
Antigen
Fibroblast growth factor 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKE
ILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVS
PTMKVTHFL
Storage
-20C
Provider Type Product Number
- No reagents -