Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00201514-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00201514-B01, RRID:AB_1018835
- Product name
- ZNF584 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human ZNF584 protein.
- Antigen sequence
MAGEAEAQLDPSLQGLVMFEDVTVYFSREEWGLLN
VTQKGLYRDVMLENFALVSSLGLAPSRSPVFTQLE
DDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVED
ERAHPEHLKSYRVIQHQDTHSEGKPRRHTEHGAAF
PPGSSCGQQQEVHVAEKLFKCSDCGKVFLKAFALL
DHLITHSEERPFRCPTGRSAFKKSAHINPRKIHTG
ETAHVCNECGKAFSYPSKLRKHQKVHTGIKPFKCS
DCGKTFNRKDALVLHQRIHTGERPYECSKCGKTFS
VLSTLIRHRKVHIGERPYECTECGKFFKYNNSFIL
HQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTG
ERPYECSLCGKTFTTRSYRNRHQQFHTEERSYECT
ECGKAFKHSSTLLQHKKVHTPERRQEDRAHGKVVS
C- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZNF584 expression in transfected 293T cell line (H00201514-T01) by ZNF584 MaxPab polyclonal antibody.Lane 1: ZNF584 transfected lysate(46.31 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to ZNF584 on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to ZNF584 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol