HPA023400

ZNF584 antibody from Sigma-Aldrich
FLJ39899
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023400
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023400, RRID:AB_1859195
Product name
Anti-ZNF324B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023400
Antibody type
Polyclonal
Antigen
Zinc finger protein 324B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPFVCTQCGRAFRERPALLHHQRIHTTEKTNAAAP
DCTPGPGFLQGHHRKVRRGGKPSPVLKPAKV
Storage
-20C
Provider Type Product Number
- No reagents -