Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30063 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FADS1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against synthetic peptide of human FADS1.
- Antigen sequence
FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQS
LCAKHGIEYQSKPLL- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of K562 cell lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 2.5 ug/mL working concentration.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of human fetal liver tissue lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 1 ug/mL working concentration.