Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001170 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001170, RRID:AB_1080042
- Product name
- Anti-SNRPD3
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQ
MSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDML
KNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGR
GRGMGRGNI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models
Protein methylation and stress granules: posttranslational remodeler or innocent bystander?
EGFP-FMRP Granules Are Proto-Granules That Can Be Shunted to Stress Granules During a Stress Response
Chan-Penebre E, Kuplast K, Majer C, Boriack-Sjodin P, Wigle T, Johnston L, Rioux N, Munchhof M, Jin L, Jacques S, West K, Lingaraj T, Stickland K, Ribich S, Raimondi A, Scott M, Waters N, Pollock R, Smith J, Barbash O, Pappalardi M, Ho T, Nurse K, Oza K, Gallagher K, Kruger R, Moyer M, Copeland R, Chesworth R, Duncan K
Nature Chemical Biology 2015 April;11(6):432-437
Nature Chemical Biology 2015 April;11(6):432-437
Protein methylation and stress granules: posttranslational remodeler or innocent bystander?
Xie W, Denman RB
Molecular biology international 2011;2011:137459
Molecular biology international 2011;2011:137459
EGFP-FMRP Granules Are Proto-Granules That Can Be Shunted to Stress Granules During a Stress Response
Denman Robert
2010 Dec;():-
2010 Dec;():-
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SNRPD3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN