HPA001170

SNRPD3 antibody from Atlas Antibodies
Sm-D3, SMD3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001170
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001170, RRID:AB_1080042
Product name
Anti-SNRPD3
Provider product page
Atlas Antibodies - HPA001170
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQ
MSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDML
KNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGR
GRGMGRGNI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -