WH0005612M1

THAP12 antibody from Sigma-Aldrich
DAP4, P52rIPK, PRKRIR, THAP0
ELISA
Recommended by provider

Antibody data

Product number
WH0005612M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0005612M1, RRID:AB_1843124
Product name
Monoclonal Anti-PRKRIR antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0005612M1
Antibody type
Monoclonal
Antigen
PRKRIR (AAH21992, a.a. 1-151) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWR
IKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALL
KVLCILPVMKVENERYENGRKRLKAYLRNTLTDQR
SSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELP
TDNSETVENT* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -