H00005612-B01

THAP12 antibody from Abnova Corporation
DAP4, P52rIPK, PRKRIR, THAP0

Antibody data

Product number
H00005612-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005612-B01, RRID:AB_916028
Product name
PRKRIR MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00005612-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PRKRIR protein.
Antigen sequence
MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWR
IKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALL
KVLCILPVMKVENERYENGRKRLKAYLRNTLTDQR
SSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELP
TDNSETVENT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -