Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007569-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007569-M03, RRID:AB_566279
- Product name
- ZNF21 monoclonal antibody (M03), clone 6D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF21.
- Antigen sequence
VEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDK
CLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNL
VASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDN
GCAKL- Isotype
- IgG
- Antibody clone number
- 6D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZNF21 monoclonal antibody (M03), clone 6D11 Western Blot analysis of ZNF21 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ZNF21 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol