Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182821 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 182 (ZNF182) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF21 antibody: synthetic peptide directed towards the middle region of human ZNF21
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
RTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEK
PYKCT ECGKAFTQKS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Clustered organization of Krüppel zinc-finger genes at Xp11.23, flanking a translocation breakpoint at OATL1: a physical map with locus assignments for ZNF21, ZNF41, ZNF81, and ELK1.
Knight JC, Grimaldi G, Thiesen HJ, Bech-Hansen NT, Fletcher CD, Coleman MP
Genomics 1994 May 1;21(1):180-7
Genomics 1994 May 1;21(1):180-7
No comments: Submit comment
No validations: Submit validation data