HPA008174

SHANK2 antibody from Atlas Antibodies
CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008174
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008174, RRID:AB_1856822
Product name
Anti-SHANK2
Provider product page
Atlas Antibodies - HPA008174
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SELNSILQQMNREKLAKPGEGLDSPMGAKSASLAP
RSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRP
PDYESRTSGTRRAPSPVVSPTEMNKETLPAPLSAA
TASPSPALSDVFSLPSQPPSGDLFG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -