HPA008174

SHANK2 antibody from Sigma-Aldrich
CORTBP1, CTTNBP1, ProSAP1, SHANK, SPANK-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008174
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008174, RRID:AB_1856822
Product name
Anti-SHANK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008174
Antibody type
Polyclonal
Antigen
SH3 and multiple ankyrin repeat domains protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SELNSILQQMNREKLAKPGEGLDSPMGAKSASLAP
RSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRP
PDYESRTSGTRRAPSPVVSPTEMNKETLPAPLSAA
TASPSPALSDVFSLPSQPPSGDLFG
Storage
-20C
Provider Type Product Number
- No reagents -