Antibody data

Product number
PAB21601
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21601, RRID:AB_10967085
Product name
LYNX1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21601
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LYNX1.
Antigen sequence
IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSN
TEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTS
LCNHD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -