Antibody data

Product number
ABIN971095
Provider
antibodies-online
Product name
anti-Ly6/neurotoxin 1 (LYNX1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN971095
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYD
GYSKH ASATSCCQYY
Vial size
50ug
Provider Type Product Number
- No reagents -