HPA023711

LYNX1 antibody from Sigma-Aldrich
SLURP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023711
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023711, RRID:AB_1857244
Product name
Anti-LYNX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023711
Antibody type
Polyclonal
Antigen
Ly-6/neurotoxin-like protein 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSN
TEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTS
LCNHD
Storage
-20C
Provider Type Product Number
- No reagents -