H00025987-A01

TSKU antibody from Abnova Corporation
E2IG4, LRRC54, TSK

Antibody data

Product number
H00025987-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025987-A01, RRID:AB_606541
Product name
LRRC54 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00025987-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant LRRC54.
Antigen sequence
PGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSG
TNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREG
TYPRRPGSSPKVALHCVDTRDSAARGPTIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -