HPA012692

FGF3 antibody from Sigma-Aldrich
HBGF-3, INT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012692
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012692, RRID:AB_1848526
Product name
Anti-FGF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012692
Antibody type
Polyclonal
Antigen
INT-2 proto-oncogene protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGRLYASEHYSAECEFVERIHELGYNTYASRLYRT
VSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRR
TQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGV
QPRRRRQKQSPDNLEPS
Storage
-20C
Provider Type Product Number
- No reagents -