HPA012692

FGF3 antibody from Atlas Antibodies
HBGF-3, INT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012692
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012692, RRID:AB_1848526
Product name
Anti-FGF3
Provider product page
Atlas Antibodies - HPA012692
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RGRLYASEHYSAECEFVERIHELGYNTYASRLYRT
VSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRR
TQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGV
QPRRRRQKQSPDNLEPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -