H00221786-M01A

FAM200A antibody from Abnova Corporation
C7orf38, DKFZp727G131, FLJ36794

Antibody data

Product number
H00221786-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00221786-M01A, RRID:AB_1136922
Product name
DKFZp727G131 monoclonal antibody (M01A), clone 1A3
Provider product page
Abnova Corporation - H00221786-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DKFZp727G131.
Antigen sequence
MTPESRDTTDLSPGGTQEMEGIVIVKVEEEDEEDH
FQKERNKVESSPQVLSRSTTMNERALLSSYLVAYR
VAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKL
RTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF
AIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCC
LNLNSHITGLDLFTELENCLLGQYKLNWKHCKGIS
SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHR
EALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRL
LEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYE
LRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDI
FGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLW
QARLKSNRPSYYMFPTLLQHIEENIINEDCLKEIK
LEILLHLTSLSQTFNYYFPEEKFESLKENIWMKDP
FAFQNPESIIELNLEPEEENELLQLSSSFTLKNYY
KILSLSAFWIKIKDDFPLLSRKSILLLLPFTTTYL
CELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPD
WKELMNRQAHPSH
Isotype
IgM
Antibody clone number
1A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -