HPA017855

FAM200A antibody from Sigma-Aldrich
C7orf38, DKFZp727G131, FLJ36794
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017855
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017855, RRID:AB_1847703
Product name
Anti-AC005020.5-1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017855
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf38 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERALLSSYLVAYRVAKEKMAHTAAEKIILPACMDM
VRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLE
AMLITRLQSGIDFAIQLDESTDIASCPTLLVYVRY
VWQDDFVEDLLCCLNLNSHITGLDLFTELENCLLG
QYKLN
Storage
-20C
Provider Type Product Number
- No reagents -