HPA016932

UVRAG antibody from Sigma-Aldrich
VPS38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016932, RRID:AB_1858707
Product name
Anti-UVRAG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016932
Antibody type
Polyclonal
Antigen
UV radiation resistance-associated gene protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQA
KDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHK
GSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDY
GVYLLNKNIAQLRYQHGLGTPDL
Storage
-20C
Provider Type Product Number
- No reagents -