HPA011868

DKK3 antibody from Sigma-Aldrich
REIC, RIG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011868
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011868, RRID:AB_1847716
Product name
Anti-DKK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011868
Antibody type
Polyclonal
Antigen
Dickkopf-related protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLC
CAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITW
ELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFV
GSRDQDGEILLPREVPDEYLAASW
Storage
-20C
Provider Type Product Number
- No reagents -