HPA011868

DKK3 antibody from Atlas Antibodies
REIC, RIG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011868
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011868, RRID:AB_1847716
Product name
Anti-DKK3
Provider product page
Atlas Antibodies - HPA011868
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLC
CAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITW
ELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFV
GSRDQDGEILLPREVPDEYLAASW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -