HPA011166

ATP2B1 antibody from Sigma-Aldrich
PMCA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011166
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011166, RRID:AB_1855484
Product name
Anti-ATP2B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011166
Antibody type
Polyclonal
Antigen
Plasma membrane calcium-transporting ATPase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSD
GSYRIFSKGASEIILKKCFKILSANGEAKVFRPRD
RDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPE
WDNENDIVTGLTCIAVVGI
Storage
-20C
Provider Type Product Number
- No reagents -