Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91375 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91375, RRID:AB_2716657
- Product name
- Anti-MAP2
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLV
RSANGFPYREDEEGAFGEHGSQGTYSNTKENGING
ELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEK
EAQHKDQTAALPLAAEETANLPPSPPPSPASEQTV
T- Epitope
- Binds to an epitope located within the peptide sequence PPEIKDQGGAGEGLV as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL5420
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line SH-SY5Y.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of WM-115 cells using the Anti-MAP2 monoclonal antibody, showing specific staining in the cytosol and in microtubules in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of SH-SY5Y cells using the Anti-MAP2 monoclonal antibody, showing specific staining in the cytosol and in microtubules in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in neurons, as well as positivity in neuropil.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows positivity in a subset of neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows cytoplasmic immunoreactivity in pancreatic islets.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of positivity in lymphoid cells as expected (negative control).