Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012828 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012828, RRID:AB_1853946
- Product name
- Anti-MAP2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLV
RSANGFPYREDEEGAFGEHGSQGTYSNTKENGING
ELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEK
EAQHKDQTAALPLAAEETANLPPSPPPSPASEQTV
T- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.
The Human Protein Atlas-a tool for pathology
Andersson S, Konrad A, Ashok N, Pontén F, Hober S, Asplund A
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2013 Nov;61(11):773-84
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2013 Nov;61(11):773-84
The Human Protein Atlas-a tool for pathology
Pontén F, Jirström K, Uhlen M
The Journal of Pathology 2008 December;216(4):387-393
The Journal of Pathology 2008 December;216(4):387-393
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells and glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebral cortex shows immunoreactivity in neurons and dendrites.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows positivity in subsets of neurons and processes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse lateral septum shows immunoreactivity in neurons and processes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse globus pallidus shows immunoreactivity in dense network of dendrites.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows selective immunoreactivity in the CA1 area.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse facial nucleus shows strong positivity in neuronal cell bodies and processes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in Purkinje cells and molecular layer neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in neurons, as well as positivity in neuropil.