HPA012828

MAP2 antibody from Atlas Antibodies
MAP2A, MAP2B, MAP2C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012828
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012828, RRID:AB_1234856
Product name
Anti-MAP2
Provider product page
Atlas Antibodies - HPA012828
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLV
RSANGFPYREDEEGAFGEHGSQGTYSNTKENGING
ELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEK
EAQHKDQTAALPLAAEETANLPPSPPPSPASEQTV
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -