HPA005638

SDF2L1 antibody from Atlas Antibodies
AP000553.C22.4, OTTHUMT00000075032
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005638
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005638, RRID:AB_888919
Product name
Anti-SDF2L1
Provider product page
Atlas Antibodies - HPA005638
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVLKLLNTHHRVRLHSHDIKYGSGSGQQSVTGVEA
SDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHV
LTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDL
WTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYG
SPIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEP
SAGHD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -