HPA005638

SDF2L1 antibody from Atlas Antibodies
AP000553.C22.4, OTTHUMT00000075032
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005638
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005638, RRID:AB_1079888
Product name
Anti-SDF2L1
Provider product page
Atlas Antibodies - HPA005638
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVLKLLNTHHRVRLHSHDIKYGSGSGQQSVTGVEA
SDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHV
LTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDL
WTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYG
SPIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEP
SAGHD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -