HPA008759

CHGB antibody from Atlas Antibodies
SCG1, SgI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008759
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008759, RRID:AB_1233867
Product name
Anti-CHGB
Provider product page
Atlas Antibodies - HPA008759
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFER
RDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEK
KPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLD
QLLHYRKKSAEFPDFYDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -