HPA008759

CHGB antibody from Atlas Antibodies
SCG1, SgI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008759
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008759, RRID:AB_1846704
Product name
Anti-CHGB
Provider product page
Atlas Antibodies - HPA008759
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFER
RDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEK
KPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLD
QLLHYRKKSAEFPDFYDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -