HPA008759

CHGB antibody from Sigma-Aldrich
SCG1, SgI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008759
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008759, RRID:AB_1846704
Product name
Anti-CHGB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008759
Antibody type
Polyclonal
Antigen
Secretogranin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFER
RDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEK
KPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLD
QLLHYRKKSAEFPDFYDS
Storage
-20C
Provider Type Product Number
- No reagents -