HPA012602

CHGB antibody from Sigma-Aldrich
SCG1, SgI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012602
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012602, RRID:AB_1846706
Product name
Anti-CHGB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012602
Antibody type
Polyclonal
Antigen
Secretogranin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGH
PQEESEESNVSMASLGEKRDHHSTHYRASEEEPEY
GEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQ
SEESWDEEDKRNYPSLELDKMAHGYGEESE
Storage
-20C
Provider Type Product Number
- No reagents -