HPA014550

TMEM14EP antibody from Sigma-Aldrich
TMEM14E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014550, RRID:AB_1858096
Product name
Anti-TMEM14E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014550
Antibody type
Polyclonal
Antigen
Transmembrane protein 14E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVGSVQSPSAGFFFSELAGLDASQPSRNPKEHLSS
PVYIWDLARYYAN
Storage
-20C
Provider Type Product Number
- No reagents -