HPA008175

CRTAC1 antibody from Atlas Antibodies
ASPIC1, CEP-68, FLJ10320
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008175
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008175, RRID:AB_1847254
Product name
Anti-CRTAC1
Provider product page
Atlas Antibodies - HPA008175
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFN
NNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRII
DGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKM
VSRNVASGEMNSVLEILYPRDEDTLQDPAP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -