HPA008175

CRTAC1 antibody from Sigma-Aldrich
ASPIC1, CEP-68, FLJ10320
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008175
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008175, RRID:AB_1847254
Product name
Anti-CRTAC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008175
Antibody type
Polyclonal
Antigen
Cartilage acidic protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFN
NNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRII
DGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKM
VSRNVASGEMNSVLEILYPRDEDTLQDPAP
Storage
-20C
Provider Type Product Number
- No reagents -