HPA008176

NUCB1 antibody from Sigma-Aldrich
Calnuc, NUC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008176
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008176, RRID:AB_1845923
Product name
Anti-NUCB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008176
Antibody type
Polyclonal
Antigen
Nucleobindin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGWETVEMHPAYTEEELRRFEEELAAREAELNAKA
QRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRK
QQQQQQQGHKAPAAHPEGQLKFHPDTDDVPVPA
Storage
-20C
Provider Type Product Number
- No reagents -