HPA012612

CADM4 antibody from Sigma-Aldrich
IGSF4C, Necl-4, SynCAM4, TSLL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012612
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012612, RRID:AB_1851530
Product name
Anti-CADM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012612
Antibody type
Polyclonal
Antigen
Cell adhesion molecule 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARI
HASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNE
SLPERAEAVGETLTLPGLVSADNGTYTCEASNKHG
HARALYVLVVYDPGAVVEAQTSVPY
Storage
-20C
Provider Type Product Number
- No reagents -