HPA008188

PSMA2 antibody from Sigma-Aldrich
HC3, MU, PMSA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008188
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008188, RRID:AB_1855819
Product name
Anti-PSMA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008188
Antibody type
Polyclonal
Antigen
Proteasome subunit alpha type-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELED
AIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRL
TPTEVKDYLAAIA
Storage
-20C
Provider Type Product Number
- No reagents -