HPA008189

NPDC1 antibody from Sigma-Aldrich
CAB-, CAB1, DKFZp586J0523
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008189
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008189, RRID:AB_1854584
Product name
Anti-NPDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008189
Antibody type
Polyclonal
Antigen
Neural proliferation differentiation and control protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CWCRLQREIRLTQKADYATAKAPGSPAAPRISPGD
QRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTA
SSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHA
ALSAPLPAPSSPPALP
Storage
-20C
Provider Type Product Number
- No reagents -