HPA011777

SEZ6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011777, RRID:AB_1856758
Product name
Anti-SEZ6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011777
Antibody type
Polyclonal
Antigen
Seizure related 6 homolog isoform 1
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGS
SILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSA
PENGARSPEKQLHPAGATIHFSCAPGYVLKGQASI
KCVPGHPSHWSDPPPICRA
Storage
-20C
Provider Type Product Number
- No reagents -