HPA000853

CCDC116 antibody from Sigma-Aldrich
FLJ36046
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000853, RRID:AB_1078416
Product name
Anti-CCDC116 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000853
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 116 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQAASLVIRKYEFEKDLSKQLGFFSFPITHVLRDL
SLGLKKVKGSRIHLSSETHRSCLLRKLEESKRARQ
ASRLSTSHCSTETPSVQQEPATHTAQDQATEPCRS
LYTNLPASRQLSPLEPKLYMSACTGMGSSPPKSKD
MDNEGRDKAEI
Storage
-20C
Provider Type Product Number
- No reagents -