HPA007704

GNAI2 antibody from Sigma-Aldrich
GIP, GNAI2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007704, RRID:AB_1849230
Product name
Anti-GNAI2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007704
Antibody type
Polyclonal
Antigen
Guanine nucleotide-binding protein G(i), alpha-2 subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFAD
PSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLW
ADHGVQACFGRSREYQLNDSAAYYLNDLER
Storage
-20C
Provider Type Product Number
- No reagents -