Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000419-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000419-M05, RRID:AB_518665
- Product name
- ART3 monoclonal antibody (M05), clone 3A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ART3.
- Antigen sequence
LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASH
QQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIAL
MAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGF
QFKAF- Isotype
- IgG
- Antibody clone number
- 3A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genome-wide expression of azoospermia testes demonstrates a specific profile and implicates ART3 in genetic susceptibility.
Okada H, Tajima A, Shichiri K, Tanaka A, Tanaka K, Inoue I
PLoS genetics 2008 Feb;4(2):e26
PLoS genetics 2008 Feb;4(2):e26
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ART3 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ART3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol